PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.001G486000.1.p
Common NameSb01g045500, SORBIDRAFT_01g045500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family NF-YA
Protein Properties Length: 249aa    MW: 27004 Da    PI: 8.7007
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.001G486000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA106.91.7e-33137193158
             CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                           +ep+YVNaKQy++Il+RRq Rakle+e+kl  ksrkpylheSRh hA++R+Rg+gGrF
  Sobic.001G486000.1.p 137 EEPIYVNAKQYHAILRRRQLRAKLEAENKL-VKSRKPYLHESRHLHAMKRARGTGGRF 193
                           69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.1E-38135196IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115239.221136196IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.5E-29138193IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.2E-24139161IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860141161IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.2E-24170193IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010262Biological Processsomatic embryogenesis
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MLPPHLTENG TVMIQFGHQM PDYDSPATQS TSESHQEVSG MSEGSLNEHN DHSGNLDGYS  60
KSDENKMMSA LSLGNPETAY AHPKPDRTQS FAISYPYADP YYGGAVAAYG SHAIMHPQLV  120
GMVSSSRVPL PIEPAAEEPI YVNAKQYHAI LRRRQLRAKL EAENKLVKSR KPYLHESRHL  180
HAMKRARGTG GRFLNTKQQP ESPGSGSGGG SSDAQRMPMN GGGLFTKHEH SLPPGDRHHY  240
HARGGGGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-23137205274NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0621000.0BT062100.1 Zea mays full-length cDNA clone ZM_BFb0214I24 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465770.11e-177hypothetical protein SORBIDRAFT_01g045500
SwissprotQ9LVJ72e-46NFYA6_ARATH; Nuclear transcription factor Y subunit A-6
TrEMBLC5WVV81e-177C5WVV8_SORBI; Putative uncharacterized protein Sb01g045500
STRINGSb01g045500.11e-177(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Representative plantOGRP6801672
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G14020.11e-42nuclear factor Y, subunit A6